Protein Info for HUW76_02230 in Fusobacterium nucleatum SB010

Annotation: ketoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III
  • amino acids 4 to 326 (323 residues), 406.9 bits, E=2.8e-126
• PF00108: Thiolase_N
  • amino acids 36 to 150 (115 residues), 35.2 bits, E=1.8e-12
• PF07451: SpoVAD
  • amino acids 49 to 138 (90 residues), 24.3 bits, E=2.6e-09
• PF08545: ACP_syn_III
  • amino acids 107 to 185 (79 residues), 99.1 bits, E=2.1e-32
• PF08541: ACP_syn_III_C
  • amino acids 237 to 326 (90 residues), 114.3 bits, E=4.6e-37

Best Hits

Swiss-Prot: 88% identical to FABH_FUSNN: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 88% identity to fnu:FN0148)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.180

Use Curated BLAST to search for 2.3.1.180

Protein Sequence (328 amino acids)

>HUW76_02230 ketoacyl-ACP synthase III (Fusobacterium nucleatum SB010)
MQSIGIKGIGYYVPENVFTNFDFEKIIDTSDEWIRTRTGIVERRFASKDQATSDLACEAA
LKAIKNAKINKEDVDMIILATTTPDYIAQGASCIVQHKLGLKNIPCFDVNAACTGFIYSL
SVAYALVNSKLYKNILVIGAETLTRIIDIKNRNTAVLFGDGAAAAIVGEVEEGYGILGFS
IGAEGEDDMILKVPAGGSKKPNDEETVKNRENFVVMKGQEVFKFAVRVLPKVTLEALKKA
KLNVQDLSMIFPHQANLRIIESAAKRMKFPLEKFYMNLSRYGNTSSASVGIALGEAIEKG
LIKKGDNIALTGFGGGLTYGSVIIKWAY