Protein Info for HUW76_02225 in Fusobacterium nucleatum SB010

Annotation: phosphate acyltransferase PlsX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02504: FA_synthesis
  • amino acids 1 to 323 (323 residues), 378.4 bits, E=1.4e-117
• TIGR00182: fatty acid/phospholipid synthesis protein PlsX
  • amino acids 1 to 330 (330 residues), 381.7 bits, E=1.5e-118

Best Hits

Swiss-Prot: 95% identical to PLSX_FUSNN: Phosphate acyltransferase (plsX) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 95% identity to fnu:FN0147)

MetaCyc: 38% identical to acyl phosphate synthase subunit (Streptococcus pneumoniae R6)
RXN-9590 [EC: 2.3.1.274]

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (11/13 steps found)
• CDP-diacylglycerol biosynthesis III (5/5 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• oleate biosynthesis III (cyanobacteria) (2/3 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• palmitoyl ethanolamide biosynthesis (2/6 steps found)
• superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
• diacylglycerol and triacylglycerol biosynthesis (2/7 steps found)
• stigma estolide biosynthesis (2/7 steps found)
• anandamide biosynthesis II (2/8 steps found)
• anandamide biosynthesis I (3/12 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15 or 2.3.1.274

Protein Sequence (332 amino acids)

>HUW76_02225 phosphate acyltransferase PlsX (Fusobacterium nucleatum SB010)
MKIALDAMSGDFAPISTVKGAIEALQEIEGLEIILVGKEGIIKEELKKYKYDTKRIEIKN
ADEVIEMTDDPVKAVREKKNSSMNVCIDLVKEKIAQASVSCGNTGALLASSQLKLKRIKG
VLRPAIAVLFPNKKEQGTLFLDLGANSDSKPEFLNQFATMGSKYMEIFSGKKNPKVALLN
IGEEETKGNELTRETYALLKENKDIDFYGNIESTKIMDGEVDVVVTDGYTGNVLLKTSEG
VGKFIFHIVKEAIMESWISKLGALLIKGAMKKVKKKTEASEYGGAIFLGLSELSLKAHGN
SNSRAIKNALKVASKFIELNFIEELRKTMEVE