Protein Info for HUW76_01355 in Fusobacterium nucleatum SB010

Annotation: DegT/DnrJ/EryC1/StrS family aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 PF01041: DegT_DnrJ_EryC1" amino acids 15 to 391 (377 residues), 412.7 bits, see alignment E=2.4e-127 PF01212: Beta_elim_lyase" amino acids 31 to 274 (244 residues), 33.3 bits, see alignment E=5.1e-12 PF00266: Aminotran_5" amino acids 56 to 181 (126 residues), 25.8 bits, see alignment E=7.9e-10

Best Hits

KEGG orthology group: None (inferred from 63% identity to cbk:CLL_A3372)

Predicted SEED Role

"erythromycin biosynthesis sensory transduction protein eryC1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>HUW76_01355 DegT/DnrJ/EryC1/StrS family aminotransferase (Fusobacterium nucleatum SB010)
MKVSLLNLKRQYKYLKKNIETTISEILEGGAYINGPQTKKFEKRMEEYLGVKHAIGVGNG
TDALVIALEALGIGKGDEVITSPFTFFATAEAISVVGAISVFVDVKLEDFNIDENKIEKA
ITPKTKAIIPVHIFGTPANMDRINEIAKKNNLYVIEDACQAIGAKYKDKMVGTLSDIACF
SFFPTKNLGTYGDGGLITTNDDSFATICRALKAHGSGENGEIAYNSLNNIEEEVKIDNQV
DDTVYNPKKYYNYLIGHNSRLDELHAGILNVKLNYLDEWNKKRNDIAKYYNEKLDDKKYK
KMQLREDNYNVYHMYIIQTENRNELTKKLDEAGIAYGVYYPVPLHLQKVYKNLGYKEGDL
PNAEYLSKRTLAIPVDPELTVKEREYIVEFLNNLEL