Protein Info for HUW76_01185 in Fusobacterium nucleatum SB010

Annotation: GTPase ObgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 TIGR02729: Obg family GTPase CgtA" amino acids 2 to 329 (328 residues), 446.3 bits, see alignment E=5.8e-138 PF01018: GTP1_OBG" amino acids 3 to 157 (155 residues), 200.7 bits, see alignment E=2.1e-63 PF02421: FeoB_N" amino acids 160 to 250 (91 residues), 42.9 bits, see alignment E=7.5e-15 PF01926: MMR_HSR1" amino acids 160 to 283 (124 residues), 93.2 bits, see alignment E=2.4e-30 TIGR03595: Obg family GTPase CgtA, C-terminal extension" amino acids 357 to 426 (70 residues), 67.6 bits, see alignment E=6.4e-23 PF09269: DUF1967" amino acids 357 to 426 (70 residues), 55.3 bits, see alignment E=1.1e-18

Best Hits

Swiss-Prot: 96% identical to OBG_FUSNN: GTPase Obg (obg) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K03979, GTP-binding protein (inferred from 96% identity to fnu:FN1918)

Predicted SEED Role

"GTP-binding protein Obg"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>HUW76_01185 GTPase ObgE (Fusobacterium nucleatum SB010)
MFIDEVIITVKAGNGGDGSAAFRREKFVQFGGPDGGDGGKGGDVIFIADSNINTLIDFKF
KKLFKAGNGENGQKKQMYGKKGEDLIIKVPVGTQVRDFTTGKLILDMSVNGEQRVLLKGG
KGGYGNVHFKNSIRKAPKIAEKGGEGAEIKVKLELKLLADVALVGYPSVGKSSFINKVSA
ANSKVGSYHFTTLEPKLGVVRLEEGKSFVIADIPGLIEGAHEGVGLGDKFLRHIERCKMI
YHIVDAAEIEGRDCIEDFEKINYELKKFSEKLAHKKQIVIANKMDLIWDMKKYNKFKDYL
TEKGIEIYPVSVLLNEGLKEVLYKTYDMLSHIEREPLEEETDISKLLKELKIEKEDFEIT
RDEENAIIVGGRIVDDVLAKYVIGMDDESLVTFLHMMRSLGMEEALQEFGVEDGDTVKIA
DVEFEYFE