Protein Info for HUW76_01170 in Fusobacterium nucleatum SB010

Annotation: tRNA 2-thiouridine(34) synthase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 PF02540: NAD_synthase" amino acids 2 to 117 (116 residues), 40.7 bits, see alignment E=6.1e-14 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 2 to 342 (341 residues), 295.1 bits, see alignment E=3.1e-92 PF03054: tRNA_Me_trans" amino acids 2 to 192 (191 residues), 212.9 bits, see alignment E=1.6e-66 PF00764: Arginosuc_synth" amino acids 3 to 115 (113 residues), 30.9 bits, see alignment E=1.1e-10 PF06508: QueC" amino acids 3 to 177 (175 residues), 36.6 bits, see alignment E=1.4e-12 PF02568: ThiI" amino acids 3 to 115 (113 residues), 26.9 bits, see alignment E=1.4e-09 PF00733: Asn_synthase" amino acids 7 to 67 (61 residues), 21.2 bits, see alignment E=8.6e-08 PF20259: tRNA_Me_trans_M" amino acids 196 to 260 (65 residues), 63 bits, see alignment E=6.2e-21

Best Hits

Swiss-Prot: 91% identical to MNMA2_FUSNN: tRNA-specific 2-thiouridylase MnmA 2 (mnmA2) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 91% identity to fnu:FN1920)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>HUW76_01170 tRNA 2-thiouridine(34) synthase MnmA (Fusobacterium nucleatum SB010)
MKKVVIGMSGGVDSSVSAYLLKEQGYEVIGVTLNQYLEENSKDIEDTKKVCDKLGIIHEV
VNIRKDFENIVIKYFLDGYKSGKTPSPCVICDDEIKFKILFDIADKYKAEYVATGHYTSV
EYSEIFSKYLLKSVHSIIKDQSYMLYRLSPNKLERLIFPLKYYTKQEIREIALKLGLEIY
NKKDSQGICFAKEGYKEFLKENLKDKIVRGNYVDKDGNILGEHEGYQLYTMGQRRGLGIN
LSKPIFITEIKPQTNEIVLGEFSELFTDKVELINYKFSVEYEKLENLELLARPRFSSTGF
YGKIIKDKDKIYFKYNEENAHNAKGQHIVFFYDGFVVGGGEIK