Protein Info for HUW76_00820 in Fusobacterium nucleatum SB010

Annotation: ethanolamine utilization protein EutJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR02529: ethanolamine utilization protein EutJ family protein" amino acids 32 to 269 (238 residues), 385.4 bits, see alignment E=4.8e-120 PF06723: MreB_Mbl" amino acids 59 to 174 (116 residues), 36.7 bits, see alignment E=4.7e-13 PF00012: HSP70" amino acids 75 to 212 (138 residues), 50.3 bits, see alignment E=2.4e-17 PF14450: FtsA" amino acids 142 to 263 (122 residues), 39.1 bits, see alignment E=1.8e-13 PF11104: PilM_2" amino acids 143 to 252 (110 residues), 34.7 bits, see alignment E=2.1e-12

Best Hits

Swiss-Prot: 40% identical to EUTJ_ECOLI: Ethanolamine utilization protein EutJ (eutJ) from Escherichia coli (strain K12)

KEGG orthology group: K04024, ethanolamine utilization protein EutJ (inferred from 89% identity to fnu:FN1783)

Predicted SEED Role

"Ethanolamine utilization protein EutJ" in subsystem Ethanolamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>HUW76_00820 ethanolamine utilization protein EutJ (Fusobacterium nucleatum SB010)
MNLNKVNKYIKDFEKTITKPKTNFDKSKFYVGVDLGTANIVITILDKNGNPIAGATQRSR
VVRDGIVVDFMGAISIVKKLKQDLEEKLGIEITEGCTAIPPGVEQGSVKAIVNVIESAGI
DILKVIDEPTAASYVLGITDGVVVDLGGGTTGISILEKGKVVFVADEPTGGTHMTLVLAG
SYGVDFETAEDIKTDKKKEKEVFTQITPVLEKMASIVKKYIKGYKVKDVFLVGGACSFAD
SEKIFEKELGLNIYKPYMPIYITPIGIALAGMKD