Protein Info for HUW76_00415 in Fusobacterium nucleatum SB010

Annotation: acetaldehyde dehydrogenase (acetylating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02518: acetaldehyde dehydrogenase (acetylating)
  • amino acids 2 to 479 (478 residues), 872.3 bits, E=5.1e-267
• PF00171: Aldedh
  • amino acids 9 to 268 (260 residues), 81.8 bits, E=2e-27

Best Hits

Swiss-Prot: 38% identical to SUCD_CLOK5: Succinate-semialdehyde dehydrogenase (acetylating) (sucD) from Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)

KEGG orthology group: None (inferred from 92% identity to fnu:FN0084)

MetaCyc: 38% identical to succinate semialdehyde dehydrogenase subunit (Clostridium kluyveri)
RXN-8891 [EC: 1.2.1.76]

Predicted SEED Role

"Acetaldehyde dehydrogenase, ethanolamine utilization cluster (EC 1.2.1.10)" (EC 1.2.1.10)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (17/19 steps found)
• ethanolamine utilization (5/5 steps found)
• superpathway of N-acetylneuraminate degradation (17/22 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• pyruvate fermentation to ethanol III (3/3 steps found)
• L-threonine degradation IV (2/2 steps found)
• ethanol degradation I (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• heterolactic fermentation (13/18 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (9/13 steps found)
• superpathway of purine deoxyribonucleosides degradation (4/7 steps found)
• 2-aminoethylphosphonate degradation I (1/3 steps found)
• 2-deoxy-α-D-ribose 1-phosphate degradation (1/3 steps found)
• 2-deoxy-D-ribose degradation I (1/3 steps found)
• 2-hydroxypenta-2,4-dienoate degradation (1/3 steps found)
• sulfoacetaldehyde degradation IV (1/3 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (11/17 steps found)
• succinate fermentation to butanoate (3/7 steps found)
• superpathway of pyrimidine deoxyribonucleosides degradation (2/6 steps found)
• catechol degradation I (meta-cleavage pathway) (1/5 steps found)
• superpathway of L-threonine metabolism (10/18 steps found)
• triethylamine degradation (1/6 steps found)
• mixed acid fermentation (8/16 steps found)
• catechol degradation II (meta-cleavage pathway) (1/7 steps found)
• toluene degradation I (aerobic) (via o-cresol) (1/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (1/7 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (1/8 steps found)
• p-cumate degradation (1/8 steps found)
• meta cleavage pathway of aromatic compounds (1/10 steps found)
• p-cymene degradation (1/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (6/18 steps found)
• L-tryptophan degradation IX (1/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (1/12 steps found)
• naphthalene degradation to acetyl-CoA (1/12 steps found)
• toluene degradation IV (aerobic) (via catechol) (1/13 steps found)
• crotonyl-CoA/ethylmalonyl-CoA/hydroxybutyryl-CoA cycle (engineered) (1/14 steps found)
• mandelate degradation to acetyl-CoA (2/18 steps found)
• superpathway of aerobic toluene degradation (3/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (4/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (3/42 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.10 or 1.2.1.76

Protein Sequence (480 amino acids)

>HUW76_00415 acetaldehyde dehydrogenase (acetylating) (Fusobacterium nucleatum SB010)
MDKDLLSIQQVRDLIKSAKVAQKLYSTFTQEQIDKVIYAIVQEMRNHYVDLAKKAHEETG
FGKCEDKVIKNRFANEFVYDYIKDMKTVGVLKETDTITEIGVPMGIVAALTPSTNPTSTA
IYKTLISLKAGNAIIVSPHPNAKDCVIDTVKLMQKAAYAAGAPVGLIGVIEIPTMEGTNE
LMKSKDTSIILATGGEAMVRAAYSSGRPAIGVGPGNGPAFIEKSANVKEAVRKIVESKTF
DNGVICASEQSVIVEPCNKEAVMEEFRKQGGYFLSKEESEKLGRFILRANGTMNPQIVGK
DAQTLAKLSGLNIPSNVKLLLSEQSTVSKSNPYSREKLTTILAFYVEDNPEKACERAIEL
LENEGKGHTLIIHSENKDIIREFALKKPVSRMLVNVGGSLGGVGATTDLAPAFTLGCGAV
GGSSTSDNITPMNLINIRRVAVGVRELSDLKKDTNTSSNLDVTNSEVEDMIRRIIAEYRK