Protein Info for HUW76_00260 in Fusobacterium nucleatum SB010

Annotation: endonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 TIGR01083: endonuclease III" amino acids 5 to 196 (192 residues), 258.2 bits, see alignment E=2.1e-81 PF00730: HhH-GPD" amino acids 35 to 171 (137 residues), 86 bits, see alignment E=2.2e-28 PF00633: HHH" amino acids 100 to 127 (28 residues), 25.4 bits, see alignment (E = 9.4e-10)

Best Hits

Swiss-Prot: 47% identical to END3_HAEIN: Endonuclease III (nth) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K10773, endonuclease III [EC: 4.2.99.18] (inferred from 94% identity to fnu:FN0057)

Predicted SEED Role

"Endonuclease III (EC 4.2.99.18)" in subsystem Control of cell elongation - division cycle in Bacilli or DNA Repair Base Excision (EC 4.2.99.18)

Isozymes

Compare fitness of predicted isozymes for: 4.2.99.18

Use Curated BLAST to search for 4.2.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>HUW76_00260 endonuclease III (Fusobacterium nucleatum SB010)
MTKKEKVKKILEELEKKFGEPKCALDFKTPFELLVAVILSAQCTDKRVNIVTDEMFKHVN
TPEQFANMKLEEIENYIKSTGFFRNKAKNIKKCSEQLLEKYNGEVPQDMDKLTELAGVGR
KTANVVRGDIWGLADGITVDTHVKRLSNLIGLVDSEDPIKIELELMKIVPKKSWINFSHY
LILHGRATCIARRPRCSECEISKYCNYGIKKLSNEN