Protein Info for HUW76_00090 in Fusobacterium nucleatum SB010

Annotation: galactokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 TIGR00131: galactokinase" amino acids 4 to 387 (384 residues), 444.6 bits, see alignment E=1.5e-137 PF10509: GalKase_gal_bdg" amino acids 8 to 57 (50 residues), 78.8 bits, see alignment 2.6e-26 PF00288: GHMP_kinases_N" amino acids 115 to 181 (67 residues), 61.6 bits, see alignment E=1.2e-20 PF08544: GHMP_kinases_C" amino acids 286 to 367 (82 residues), 44.4 bits, see alignment E=2.7e-15

Best Hits

Swiss-Prot: 95% identical to GAL1_FUSNN: Galactokinase (galK) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K00849, galactokinase [EC: 2.7.1.6] (inferred from 95% identity to fnu:FN2107)

Predicted SEED Role

"Galactokinase (EC 2.7.1.6)" in subsystem Lactose and Galactose Uptake and Utilization (EC 2.7.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>HUW76_00090 galactokinase (Fusobacterium nucleatum SB010)
MLETLIKDFKEIFKYNGEVETFFSPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKRED
KIFRMYSKNFQNLGIIEFNLDNLVYDKKDNWANYPKGVIKTFLDKNYKIDSGFDVLFFGN
IPNGAGLSSSASIEVLTAVILKDLFKLDVDMVEMVKMCQVAENKFIGVNSGIMDQFAVGM
GKKDNAILLDCNTLKFEYVPVKLMNMSIVIANTNKKRGLADSKYNERRTSCEEAVKVLNK
NGINIKYLGELTVAEFEKVKHFLTDEEQLKRATHAVTENERAKIAVEFLKKDDIAEFGRL
MNKSHISLRDDYEVTGLELDSLVEAAWEEKGTVGSRMTGAGFGGCTVSIVENDYVDSFIK
NVGKKYKEKTGLEASFYIANIGDGAGKKGL