Protein Info for HMPREF1181_RS17145 in Bacteroides stercoris CC31F

Annotation: 50S ribosomal protein L36

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 38 PF00444: Ribosomal_L36" amino acids 1 to 38 (38 residues), 77.9 bits, see alignment E=2.4e-26 TIGR01022: ribosomal protein bL36" amino acids 1 to 38 (38 residues), 56.7 bits, see alignment E=9.8e-20

Best Hits

Swiss-Prot: 100% identical to RL36_BACFN: 50S ribosomal protein L36 (rpmJ) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: None (inferred from 95% identity to pgt:PGTDC60_0185)

MetaCyc: 60% identical to 50S ribosomal subunit protein L36 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (38 amino acids)

>HMPREF1181_RS17145 50S ribosomal protein L36 (Bacteroides stercoris CC31F)
MKVRASLKKRTPECKIVRRNGRLYVINKKNPKYKQRQG