Protein Info for HMPREF1181_RS16935 in Bacteroides stercoris CC31F

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 51 to 266 (216 residues), 72.2 bits, see alignment E=1.2e-23 PF00535: Glycos_transf_2" amino acids 55 to 218 (164 residues), 66.2 bits, see alignment E=7.1e-22 PF13506: Glyco_transf_21" amino acids 117 to 249 (133 residues), 33.5 bits, see alignment E=5.9e-12 PF13632: Glyco_trans_2_3" amino acids 133 to 341 (209 residues), 56.7 bits, see alignment E=6.3e-19

Best Hits

KEGG orthology group: None (inferred from 77% identity to bhl:Bache_2626)

Predicted SEED Role

"Glycosyl transferase, group 2 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>HMPREF1181_RS16935 glycosyltransferase family 2 protein (Bacteroides stercoris CC31F)
MKICETVFWISLLVIFYTYIGYGMLLYVLVRLKECFRQTPPPPLPADCMLPELTLFITAY
NEEDVVDDKMRNSLSLDYPADKLHILWITDGSNDRTNERLSHWPQATVLYQSQREGKTAA
LNRGIRSVTTPLVVFTDANTHLNRKALREIVRAFANPKVGCVAGEKRIAVQDKPNAASGG
EGLYWKYESALKKLDSRLYSAVGAAGELFAIRRELFEEMPADTLLDDFVLSLRIVMRGYT
IAYCADAYAVENGSADMHEEEKRKVRIAAGGLQSVWRLRALLNPLRYGVFSFQYISHRVL
RWSLTPVLLFLLFPLNTILIFTSNTPLLYAVIWLLQALFYFMASWGHYLSAKHIKNKILF
VPYYFLFMNINVVRGFNYLRKRRGQAGGTWEKARRA