Protein Info for HMPREF1181_RS16135 in Bacteroides stercoris CC31F

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 46 to 69 (24 residues), see Phobius details amino acids 89 to 106 (18 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 244 to 261 (18 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details amino acids 306 to 327 (22 residues), see Phobius details amino acids 339 to 357 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 16 to 353 (338 residues), 153.7 bits, see alignment E=3.3e-49

Best Hits

KEGG orthology group: None (inferred from 56% identity to tsa:AciPR4_4164)

Predicted SEED Role

"Acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>HMPREF1181_RS16135 acyltransferase (Bacteroides stercoris CC31F)
MNTQNSYLASKPHYEILDGLRGVAAVMVVAFHLLEAHSGGNHLEQIINHGYLAVDFFFML
SGFVIGYAYDDRWSRMSIGTFFKRRIIRLHPMVIVGSIVGAVFFYFQESPCFPAIQDTSA
GTMLLVMLLGCTLLPLPLKWDIRGWTEMHPLNGPAWSLYYEYIGNILYALFIRKFSKTAL
SVLVVVAGCFTVHLCLTAPAGDIVGGWALNWEQQYVGLVRLMYPFFGGLLLSRLGWIVRI
EKRAFWWCSLMIVAVLAFPRLGGENHYWMNGLYEACCILFVFPVIVSMGAGGKVTGKRST
AVCKFLGDISYPVYITHYPLVYTYTAWVCNNNATLAEGIPYMILTFAGAFVLAYACLKLY
DEPIRKWLTDRFLKGKKAVKS