Protein Info for HMPREF1181_RS15690 in Bacteroides stercoris CC31F

Annotation: 1,4-dihydroxy-2-naphthoyl-CoA synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 TIGR01929: naphthoate synthase" amino acids 13 to 270 (258 residues), 421 bits, see alignment E=9.6e-131 PF00378: ECH_1" amino acids 20 to 269 (250 residues), 267.4 bits, see alignment E=1.1e-83 PF16113: ECH_2" amino acids 25 to 201 (177 residues), 78.7 bits, see alignment E=6.2e-26

Best Hits

Swiss-Prot: 68% identical to MENB_BACSU: 1,4-dihydroxy-2-naphthoyl-CoA synthase (menB) from Bacillus subtilis (strain 168)

KEGG orthology group: K01661, naphthoate synthase [EC: 4.1.3.36] (inferred from 97% identity to bth:BT_4702)

MetaCyc: 68% identical to naphthoyl-CoA synthase (Bacillus subtilis)
Naphthoate synthase. [EC: 4.1.3.36]

Predicted SEED Role

"Naphthoate synthase (EC 4.1.3.36)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.1.3.36)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>HMPREF1181_RS15690 1,4-dihydroxy-2-naphthoyl-CoA synthase (Bacteroides stercoris CC31F)
MQTKREWTTIREYEDILFEYYNGIARITINRERYRNAFTPTTTAEMSDALRICREEADID
VIVITGAGDKAFCSGGDQNVKGRGGYIGKDGVPRLSVLDVQKQIRSIPKPVIAAVNGFAI
GGGHVLHVVCDLSIASENAIFGQTGPRVGSFDAGFGASYLARVVGQKKAREIWFLCRKYN
AQEALEMGLVNKVVPLEQLEDEYVQWAEEMMQLSPLALRMIKAGLNAELDGQSGIQELAG
DATLLYYLTDEAQEGKNAFLEKRKPNFKQYPKFP