Protein Info for HMPREF1181_RS15670 in Bacteroides stercoris CC31F

Annotation: cobalamin biosynthesis protein CobD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 60 to 84 (25 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details TIGR00380: cobalamin biosynthesis protein CobD" amino acids 18 to 316 (299 residues), 226.8 bits, see alignment E=1.9e-71 PF03186: CobD_Cbib" amino acids 18 to 298 (281 residues), 355.1 bits, see alignment E=1.3e-110

Best Hits

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 83% identity to bhl:Bache_2256)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>HMPREF1181_RS15670 cobalamin biosynthesis protein CobD (Bacteroides stercoris CC31F)
MEDIIIFLGIAFNLNLPLLTAWLLDHWLGDPVWLPHPVVAFGKAISFCEHRLNKGNARFL
KGAVMSLVLVAGVYLLTLFLLRWAAHYSPGLLLTLQVLLIFYCLAGTTLVREVCGVFKAV
DRSLEEGRKQVARIVGRDTSGLSAQEVRTAALETLAENLSDGVIAPLFWYMLLGVPGMLA
YKMINTLDSMIGYRNERYRRFGCFAARLDDVANYIPARLTAFLMVAVSGRFPLLLFVGKY
GSKHASPNSGYPEAALAGILDCRFGGPHNYFGEEVWKPYIGDNKRPLTTEDMRIAVRINR
SVEWIMVIIVVATATCMYVIPSFF