Protein Info for HMPREF1181_RS15665 in Bacteroides stercoris CC31F

Annotation: alpha-ribazole phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00300: His_Phos_1
  • amino acids 3 to 164 (162 residues), 94.3 bits, E=4e-31
• TIGR03162: alpha-ribazole phosphatase
  • amino acids 3 to 174 (172 residues), 170.5 bits, E=1.2e-54

Best Hits

KEGG orthology group: None (inferred from 86% identity to bhl:Bache_2259)

Predicted SEED Role

"Alpha-ribazole-5'-phosphate phosphatase (EC 3.1.3.73)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 3.1.3.73)

MetaCyc Pathways

• superpathway of adenosylcobalamin salvage from cobinamide I (8/8 steps found)
• superpathway of adenosylcobalamin salvage from cobinamide II (8/9 steps found)
• 2-methyladeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• 5-hydroxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• 5-methoxy-6-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• 5-methoxybenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• 5-methylbenzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• adeninyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• adenosylcobalamin biosynthesis from adenosylcobinamide-GDP I (3/3 steps found)
• benzimidazolyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (3/3 steps found)
• 4-methylphenyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
• phenyl adenosylcobamide biosynthesis from adenosylcobinamide-GDP (2/3 steps found)
• adenosylcobalamin biosynthesis from adenosylcobinamide-GDP II (2/4 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (24/36 steps found)
• adenosylcobalamin biosynthesis II (aerobic) (20/33 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.73

Protein Sequence (176 amino acids)

>HMPREF1181_RS15665 alpha-ribazole phosphatase (Bacteroides stercoris CC31F)
MEVILIRHTSVDVPPGVCYGQTDVPLKPTFEQEAAVTQENLKAFLPFDHVYTSPLTRCVR
LATYCGYPDAERDKRIMEINFGSWEMKPFDRNDDPRLQEWYADYLNVAATGGESFAMQYR
RVSDFLDELKGKPYQRVAVFAHGGVLICAQIYAGIIKPEEAFSALTPYGGIVRITL