Protein Info for HMPREF1181_RS15335 in Bacteroides stercoris CC31F

Annotation: anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02885: Glycos_trans_3N
  • amino acids 2 to 63 (62 residues), 56.8 bits, E=1.6e-19
• TIGR01245: anthranilate phosphoribosyltransferase
  • amino acids 6 to 328 (323 residues), 302.5 bits, E=2.1e-94
• PF00591: Glycos_transf_3
  • amino acids 75 to 320 (246 residues), 209.6 bits, E=6.4e-66

Best Hits

Swiss-Prot: 78% identical to TRPD_BACV8: Anthranilate phosphoribosyltransferase (trpD) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 89% identity to bhl:Bache_2061)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Protein Sequence (331 amino acids)

>HMPREF1181_RS15335 anthranilate phosphoribosyltransferase (Bacteroides stercoris CC31F)
MKTILTRLFNHEELTVEESKQILLNISREMYPEAQIAALLTVFQMRSITVDELAGFREAL
METRIPIDFAPYRPIDIVGTGGDGKNTFNISTCASFVVAGAGYKVAKHGNYGATSVSGAS
NVIEQHGVRFTNNPDILKRSMEECNIAYLHAQLFNPAMKFVGPVRKALGVRTLFNLLGPL
VNPCQPAYQLLGVADLAQMRLYTNVFYRLGIDFAVVNSLDNYDEISLTDEFKVMTRHYER
IYRPQALGFSAVRPEELSGGACKEDAARIFDNILNNRAEAAQTQCVIVNAAFAIQVMEPE
KEIEECIAIARESLESGRALKTLKKFIEINQ