Protein Info for HMPREF1181_RS14705 in Bacteroides stercoris CC31F

Annotation: bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00097: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase
  • amino acids 7 to 262 (256 residues), 310.8 bits, E=3.1e-97
• PF08543: Phos_pyr_kin
  • amino acids 14 to 259 (246 residues), 304.5 bits, E=5.4e-95
• PF00294: PfkB
  • amino acids 84 to 238 (155 residues), 30.2 bits, E=3e-11

Best Hits

Swiss-Prot: 40% identical to THID_AQUAE: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 68% identity to bhl:Bache_2367)

MetaCyc: 43% identical to bacimethrin diphosphokinase (Clostridium botulinum A str. ATCC 19397)
2.7.6.-

Predicted SEED Role

"Hydroxymethylpyrimidine phosphate kinase ThiD (EC 2.7.4.7)" (EC 2.7.4.7)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis I (2/2 steps found)
• hydroxymethylpyrimidine salvage (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (4/7 steps found)
• thiamine diphosphate salvage IV (yeast) (4/7 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (4/8 steps found)
• bacimethrin and bacimethrin pyrophosphate biosynthesis (1/4 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (2/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Protein Sequence (300 amino acids)

>HMPREF1181_RS14705 bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (Bacteroides stercoris CC31F)
MSTIPVILTIAGSDCSGGAGIQADIKTISALKGYAASVITAVTAQNTMGVQAVCPIPPDI
VRAQITSVMDDLQPAAIKIGMVHNAAIVHTVAECLQKFRPRFVVYDPVMVSTSGRKLMTE
DTVRTIQAELFPLCSLITPNLGEASLLLSNPVTDIEEMKLAACELANRYHCAVLVKGGHL
SGNTMCDVLYNNGRFSLFEQQKIESGNLHGTGCTLSSAIAAFAARNNGLEEAVRQAKVYI
SKAICHGKDLHIGHGNGPLCHFFSGEINFVPLNSTEEVIRKFPHKQQAEYREENFQGETS