Protein Info for HMPREF1181_RS14705 in Bacteroides stercoris CC31F

Annotation: bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 TIGR00097: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase" amino acids 7 to 262 (256 residues), 310.8 bits, see alignment E=3.1e-97 PF08543: Phos_pyr_kin" amino acids 14 to 259 (246 residues), 304.5 bits, see alignment E=5.4e-95 PF00294: PfkB" amino acids 84 to 238 (155 residues), 30.2 bits, see alignment E=3e-11

Best Hits

Swiss-Prot: 40% identical to THID_AQUAE: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 68% identity to bhl:Bache_2367)

MetaCyc: 43% identical to bacimethrin diphosphokinase (Clostridium botulinum A str. ATCC 19397)
2.7.6.-

Predicted SEED Role

"Hydroxymethylpyrimidine phosphate kinase ThiD (EC 2.7.4.7)" (EC 2.7.4.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>HMPREF1181_RS14705 bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (Bacteroides stercoris CC31F)
MSTIPVILTIAGSDCSGGAGIQADIKTISALKGYAASVITAVTAQNTMGVQAVCPIPPDI
VRAQITSVMDDLQPAAIKIGMVHNAAIVHTVAECLQKFRPRFVVYDPVMVSTSGRKLMTE
DTVRTIQAELFPLCSLITPNLGEASLLLSNPVTDIEEMKLAACELANRYHCAVLVKGGHL
SGNTMCDVLYNNGRFSLFEQQKIESGNLHGTGCTLSSAIAAFAARNNGLEEAVRQAKVYI
SKAICHGKDLHIGHGNGPLCHFFSGEINFVPLNSTEEVIRKFPHKQQAEYREENFQGETS