Protein Info for HMPREF1181_RS14630 in Bacteroides stercoris CC31F

Annotation: bifunctional GNAT family N-acetyltransferase/carbon-nitrogen hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 PF00583: Acetyltransf_1" amino acids 35 to 145 (111 residues), 25 bits, see alignment E=2e-09 PF00795: CN_hydrolase" amino acids 226 to 487 (262 residues), 110.3 bits, see alignment E=1.1e-35

Best Hits

Swiss-Prot: 45% identical to YHCX_BACSU: Hydrolase YhcX (yhcX) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 95% identity to bhl:Bache_2350)

Predicted SEED Role

"Aliphatic amidase AmiE (EC 3.5.1.4)" (EC 3.5.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>HMPREF1181_RS14630 bifunctional GNAT family N-acetyltransferase/carbon-nitrogen hydrolase family protein (Bacteroides stercoris CC31F)
MDEIKINKVQIRNLQIEDYDQLAQSFTRVYSDGSDVFWTHKQIEKLIRIFPEGQIVTVVD
EKIVGCALSIIVNYDDVKNDHTYAQVTGKETFNTHNPKGNILYGIEVFIHPQYRGLRLAR
RMYEYRKEICETLNLKAIMFGGRIPNYHKYADQLRPKEYIDKVKQKEIYDPVLTFQLSND
FHVRKVMRNYLPNDEESKHYACLLQWDNIYYQAPTQEYVSPKTTVRVGLVQWQMRTYKTL
DDLFEQVEFFVDAVSDYKSDFVLFPEYFNAPLMAKFNDEGESEAIRGLAAYTNEIRERFV
KLAISYNINIITGSMPLIKEEDGRLYNVGFLCRRDGTYEMYEKIHVTPDEIKSWGLSGGK
SLQTFDTDCAKIGVLICYDVEFPELSRIMADQGMQILFVPFLTDTQNAYSRVKVCAHARA
IENECFVVIAGSVGNLPRVHNMDIQYAQSGVFTPCDFAFPTDGKRAEATPNTEMILVSDV
DLDLLNELHTYGSVRNLKDRRNDLYEVKMKK