Protein Info for HMPREF1181_RS14280 in Bacteroides stercoris CC31F

Annotation: efflux transporter outer membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 54 to 471 (418 residues), 331.3 bits, see alignment E=5e-103 PF02321: OEP" amino acids 71 to 259 (189 residues), 91.6 bits, see alignment E=2.8e-30 amino acids 291 to 469 (179 residues), 88 bits, see alignment E=3.5e-29

Best Hits

KEGG orthology group: None (inferred from 72% identity to bfr:BF2391)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (479 amino acids)

>HMPREF1181_RS14280 efflux transporter outer membrane subunit (Bacteroides stercoris CC31F)
MTLKAWSSTLLILCFSFAAWAQKGNSYLEKPLPQGWGTGTAHTISGDDNLFGSQIQPVDD
KWWKAFGDPMLDSLIATASAGNFSVLSAIDRMDMAKANWRIERGSFFPSVSLNGGWARQQ
SSGNVSEAPQSRTGAYSASLNASWELDIFGSIRQRVKAQRENFAASKEEYTSVMISLCAQ
VASAYIGLRELQQELNVVIRNCNTQAAVLEITQVRYKTGLVSKLDVSQAKSVYYSTKASV
PQLEAGINQYITTLAILLGTYPQDLRPTLEQNGKLPDYMEPVGIGIPADLLLRRPDIRQA
ERQINAQAALLGASKSDWLPQVFLKGSVGYSSHDLKDFTKRNSMTFEIAPSLSWTLFNGT
KLVNATRLARAQLDESIHQFNQTVLTAVQETDNAMNGYRNSIKQIVALREVCNQGEETLK
LSLDLYKQGLTPFQNVLDALRSLLAYQNQLTQAQGNSLQELISLYKALGGGYGNIISGL