Protein Info for HMPREF1181_RS14185 in Bacteroides stercoris CC31F

Annotation: dihydroorotate dehydrogenase electron transfer subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00175: NAD_binding_1
  • amino acids 113 to 203 (91 residues), 39.8 bits, E=6.2e-14
• PF10418: DHODB_Fe-S_bind
  • amino acids 218 to 254 (37 residues), 48.8 bits, 4.6e-17

Best Hits

Swiss-Prot: 40% identical to PYRK_BACSK: Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit (pyrK) from Bacillus clausii (strain KSM-K16)

KEGG orthology group: K02823, dihydroorotate dehydrogenase electron transfer subunit (inferred from 92% identity to bhl:Bache_2300)

Predicted SEED Role

"Dihydroorotate dehydrogenase electron transfer subunit (EC 1.3.3.1)" in subsystem De Novo Pyrimidine Synthesis (EC 1.3.3.1)

MetaCyc Pathways

• UMP biosynthesis II (6/6 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.3.3.1

Use Curated BLAST to search for 1.3.3.1

Protein Sequence (258 amino acids)

>HMPREF1181_RS14185 dihydroorotate dehydrogenase electron transfer subunit (Bacteroides stercoris CC31F)
MKKYILDLTVTENVRLHANYALLKLTSPSLLPEMLPGQFAEIRVDGSPTTFLRRPISINY
VDKQRNEVWFLIQLVGDGTKRLGAAKQGDIINVVLPLGNSFTMPEKPSDKLLLVGGGVGT
APMLYLGEQLVKNGSKPTFLLGARSDKDLLQLEDFAAYGDVYTTTEDGSHGEKGYVTQHS
ILSKVNFEQIYTCGPKPMMMAVAKYAKSKGTNCEVSLENMMACGIGACLCCVENTTEGHL
CVCKEGPVFNINKLLWQI