Protein Info for HMPREF1181_RS13930 in Bacteroides stercoris CC31F

Annotation: copper homeostasis protein CutC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF03932: CutC" amino acids 5 to 204 (200 residues), 236.5 bits, see alignment E=1e-74

Best Hits

Swiss-Prot: 74% identical to CUTC_BACFN: Copper homeostasis protein CutC (cutC) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K06201, copper homeostasis protein (inferred from 79% identity to bhl:Bache_1563)

Predicted SEED Role

"Cytoplasmic copper homeostasis protein cutC" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>HMPREF1181_RS13930 copper homeostasis protein CutC (Bacteroides stercoris CC31F)
MKEYLFEVCANSVESCIAAQAGGANRVELCTGIPEGGTTPSYGDIVIAREVLQNTRLHVI
IRPRSGDFLYSPIEQRIMLKDIDNARRLGADGIVLGCLTADGEVDIPLMKQFMEAAQDIS
VTFHRAFDVCRNPQKALEDIISLGCDRILTSGQQPTAEAGIPLLKELQLQAAGRITLLAG
CGVNENNIARIARETGIHEFHFSARETVASRMQYRKERVPMGATVQINEFERNVTTQERV
KATIAQITE