Protein Info for HMPREF1181_RS13900 in Bacteroides stercoris CC31F

Annotation: S-adenosylhomocysteine/5'-methylthioadenosine nucleosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01048: PNP_UDP_1
  • amino acids 17 to 177 (161 residues), 64.3 bits, E=5.7e-22

Best Hits

KEGG orthology group: K01243, S-adenosylhomocysteine/5'-methylthioadenosine nucleosidase [EC: 3.2.2.9] (inferred from 85% identity to bhl:Bache_1574)

Predicted SEED Role

No annotation

MetaCyc Pathways

• autoinducer AI-2 biosynthesis II (Vibrio) (5/6 steps found)
• autoinducer AI-2 biosynthesis I (4/5 steps found)
• S-methyl-5'-thioadenosine degradation IV (1/1 steps found)
• S-adenosyl-L-methionine salvage I (3/4 steps found)
• S-methyl-5'-thioadenosine degradation I (1/2 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• 5'-deoxyadenosine degradation II (1/4 steps found)
• L-methionine salvage cycle II (plants) (2/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (2/12 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.9

Use Curated BLAST to search for 3.2.2.9

Protein Sequence (192 amino acids)

>HMPREF1181_RS13900 S-adenosylhomocysteine/5'-methylthioadenosine nucleosidase (Bacteroides stercoris CC31F)
MKILVTYAVQGEFTELKFPGLIGEEEVQVGYLRTGIGKVKSAFYLTEAINRAQPDLVVNV
GTAGTVRHQVGDIFVCRHFVDRDMQRLKGFDMECEIDSAALLAQKGYCLHWQREGVCNTG
DTFLTELSDVKGDVVDMEAYAQAWVCRTKNTPFIAVKYVTDIIGQNSVKHWEDKLADARK
GLGAFFESISVF