Protein Info for HMPREF1181_RS13730 in Bacteroides stercoris CC31F

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF00583: Acetyltransf_1" amino acids 46 to 121 (76 residues), 47.1 bits, see alignment E=5.6e-16 PF13673: Acetyltransf_10" amino acids 51 to 128 (78 residues), 50.2 bits, see alignment E=5.2e-17 PF13508: Acetyltransf_7" amino acids 52 to 122 (71 residues), 53 bits, see alignment E=7.4e-18 PF08445: FR47" amino acids 69 to 124 (56 residues), 24.5 bits, see alignment E=4.2e-09

Best Hits

KEGG orthology group: K03827, putative acetyltransferase [EC: 2.3.1.-] (inferred from 60% identity to cpi:Cpin_2972)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (145 amino acids)

>HMPREF1181_RS13730 GNAT family N-acetyltransferase (Bacteroides stercoris CC31F)
MKILRPTPQDYDELLTVWEASVRSTHHFLTEENIQFYKPLVRNQYFQAVELYIIRNREGK
IAAFMGLSDELIEMLFVHPDEQGKGYGKQLMQYALHEKHIYKVDVNEQNEKAHRFYLHMG
FQLIGRDETDPSGNPFPILHLQWKP