Protein Info for HMPREF1181_RS13360 in Bacteroides stercoris CC31F

Annotation: tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 PF10396: TrmE_N" amino acids 5 to 124 (120 residues), 140.5 bits, see alignment E=9.9e-45 TIGR00450: tRNA modification GTPase TrmE" amino acids 12 to 461 (450 residues), 383.8 bits, see alignment E=1.3e-118 PF12631: MnmE_helical" amino acids 127 to 458 (332 residues), 162 bits, see alignment E=8.2e-51 TIGR00231: small GTP-binding protein domain" amino acids 223 to 377 (155 residues), 84 bits, see alignment E=1e-27 PF01926: MMR_HSR1" amino acids 224 to 339 (116 residues), 94.7 bits, see alignment E=1.4e-30 PF02421: FeoB_N" amino acids 224 to 376 (153 residues), 42.3 bits, see alignment E=2e-14 PF00071: Ras" amino acids 224 to 380 (157 residues), 26.7 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 79% identical to MNME_BACTN: tRNA modification GTPase MnmE (mnmE) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 83% identity to bhl:Bache_1650)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>HMPREF1181_RS13360 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE (Bacteroides stercoris CC31F)
MNQDTICAIATAQGGAIGCIRVSGPEAIEITSCIFTPAATNRELGDSKPYTLTFGRIYDG
SEVIDEVLVSLFRAPHSYTGENSTEITCHGSAYILQKVLQLLIKNGCRMAAPGEYTQRAF
LNGKMDLSQAEAVADLIASSSAATHRLAMSQMRGGFSKELATLRDQLLHFTSLIELELDF
SDHEELEFADRSELCQLANNIEKVMARLVNSFNVGNAIKSGVPVAIIGETNAGKSTLLNV
LLNEDKAIVSDIHGTTRDIIEDTVNIGGITFRFIDTAGIRETSDTIESLGIERTFQKLDQ
AEIVLWMIDATNAQAQITQLTGQLLPRCEGKQLILVYNKADLVDNIQNSIPDNFPDNVQS
ITLSAKKREHIEELQRMLITSAHLPTITQNDVIVTNVRHYEALNNALEAIHRVQEGLTNN
ISGDFISQDIRECIFHLSDIAGEVTNDMVLQNIFQHFCIGK