Protein Info for HMPREF1181_RS12490 in Bacteroides stercoris CC31F

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details PF06580: His_kinase" amino acids 164 to 241 (78 residues), 89.2 bits, see alignment E=8.4e-30

Best Hits

KEGG orthology group: None (inferred from 77% identity to bhl:Bache_2714)

Predicted SEED Role

"putative two-component system sensor protein, no kinase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>HMPREF1181_RS12490 histidine kinase (Bacteroides stercoris CC31F)
MKQILYSRSRIIEALIHIIGWGIVFAFPFVMMTRSGFTITWMEYLRHGSIVPLSFLIVFY
CNYCFLIPRYLFEGRIRQYLLLNILLIACVTAGVHFWQEYAFHTYAKADGEGQRHIGPPK
WIFIMRDFFSMILTVGLSAAIRLSGRWVQVEAARREAEKSRTEAELKNLRNQLNPHFLLN
TLNNIYALIAFDTDKAQTAVQELSRLLRHVLYDNQQNFVTLGKEMDFIKNYIALMRIRLS
SNVTVETRFDIRPDSPTEIAPLIFISLIENAFKHGISPTEPSHIRIYFSENVHEVRCEIT
NSYHPKSEADKSGSGIGLEQVGKRLELTYPGRYAWKHGISEDGKEYKSVLTINY