Protein Info for HMPREF1181_RS12480 in Bacteroides stercoris CC31F

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 25 to 174 (150 residues), 117.8 bits, E=3e-38

Best Hits

Swiss-Prot: 58% identical to Y352_THEMA: Uncharacterized ABC transporter ATP-binding protein TM_0352 (TM_0352) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K02003, (no description) (inferred from 91% identity to bfs:BF1934)

MetaCyc: 46% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"ABC transporter ATP-binding protein"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (2/7 steps found)

Protein Sequence (248 amino acids)

>HMPREF1181_RS12480 ABC transporter ATP-binding protein (Bacteroides stercoris CC31F)
MSKTVIELQNIKRNFQVGDETVHALRGVSFSIGEGEFVTIMGTSGSGKSTLLNILGCLDT
PTVGEYLLDGISVRTMSKSQRAVLRNRKIGFVFQNYNLLAKTTAVENVELPLMYNSSVSA
TERRKRAIEALKAVGLGDRLEHKSNQMSGGQMQRVAIARALVNNPAVILADEATGNLDTR
TSFEILVLFQKLHAEGRTIIFVTHNPEIAQYSSRNIVLRDGQVKDDKPNRNILNAAETLA
ALPKQEDD