Protein Info for HMPREF1181_RS12410 in Bacteroides stercoris CC31F

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 57 to 85 (29 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 239 to 263 (25 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details amino acids 321 to 348 (28 residues), see Phobius details amino acids 360 to 378 (19 residues), see Phobius details amino acids 390 to 413 (24 residues), see Phobius details amino acids 419 to 442 (24 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 24 to 415 (392 residues), 195.3 bits, see alignment E=7.8e-62 PF01554: MatE" amino acids 24 to 187 (164 residues), 94.1 bits, see alignment E=7.6e-31 amino acids 252 to 408 (157 residues), 63.6 bits, see alignment E=1.8e-21 PF14667: Polysacc_synt_C" amino acids 140 to 260 (121 residues), 46.5 bits, see alignment E=4.3e-16

Best Hits

KEGG orthology group: None (inferred from 90% identity to bth:BT_2377)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>HMPREF1181_RS12410 MATE family efflux transporter (Bacteroides stercoris CC31F)
MTNKYEERLGTERMLPLVFKMALPAVAAQFVNLLYSIVDRIYIGHIPGIGTDALAGVGVT
ISLVVLISSFSAIVGGGGAPLAAIALGQGNRRRAGKILGNGFTLLILFTLLTSFIAYTFM
EPILLFTGASEHTLGYAEDYLSIYLLGTLFVEVSTGLNAFINAQGRPAVAMCSVLIGALL
NIILDPIFIFWLDMGVKGAALATVLSQACSAVWVLSFLFSRRASLPLERRYMKLEKSIVL
SMLALGVSPFIMASTESLVGFVLNSSLKEFGDIYVSALTVLQTSMQFASVPLTGFAQGFV
PVASYNYGHGDKQRVKECFRIALITMFSFNLVLMLFMICFPAIVASAFTSDARLIETVRW
TMPVFLGGMTIFGLQRACQNMFVALGQARISIFIALLRKVILLIPLALILPHFMGVAGVY
AAEAISDATAAICCTLLFFWQFPKILRRIKSKSLSE