Protein Info for HMPREF1181_RS11980 in Bacteroides stercoris CC31F

Annotation: preprotein translocase subunit YajC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details PF02699: YajC" amino acids 20 to 95 (76 residues), 103.9 bits, see alignment E=1.7e-34 TIGR00739: preprotein translocase, YajC subunit" amino acids 22 to 97 (76 residues), 83.6 bits, see alignment E=4.1e-28

Best Hits

Swiss-Prot: 33% identical to YAJC_BUCAI: Sec translocon accessory complex subunit YajC (yajC) from Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 93% identity to bhl:Bache_1698)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>HMPREF1181_RS11980 preprotein translocase subunit YajC (Bacteroides stercoris CC31F)
MNLMTVFFLQAPAAGPDGSMMWIMLIAMFAIMYFFMIRPQNKKQKEIANFRKSLQVNQKV
ITAGGIHGIIKEINDNDVVLEIASNVKIHIDKNSIFAAAADANSSQASK