Protein Info for HMPREF1181_RS11085 in Bacteroides stercoris CC31F

Annotation: formyltetrahydrofolate deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00655: formyltetrahydrofolate deformylase
  • amino acids 6 to 284 (279 residues), 388.5 bits, E=1e-120
• PF00551: Formyl_trans_N
  • amino acids 90 to 266 (177 residues), 155.9 bits, E=1e-49

Best Hits

Swiss-Prot: 53% identical to PURU_SYNY3: Formyltetrahydrofolate deformylase (purU) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 92% identity to bth:BT_1381)

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

• formaldehyde oxidation VII (THF pathway) (4/4 steps found)
• folate transformations I (9/13 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Protein Sequence (285 amino acids)

>HMPREF1181_RS11085 formyltetrahydrofolate deformylase (Bacteroides stercoris CC31F)
MMKTAKLLLHCPDQPGILAEVTDFITVNKGNIIYLDQYVDHVENIFFMRIEWELESFLVP
QEKIEDYFETLYAQKYGMSFRLYFSDVKPRMAIFVSKMSHCLFDLLARYTAGEWNVEIPL
IISNHPDLQHVAERFGIPFHLFPITKETKEEQEKKEMELLAKHKVNFIVLARYMQVISEK
MIGAYPNRIINIHHSFLPAFVGAKPYHAAFERGVKIIGATSHYVTTELDAGPIIEQDVVR
ITHKDTVQDLVNKGKDLEKIVLSRAVQKHIERKVLAYKNKTVIFN