Protein Info for HMPREF1181_RS10835 in Bacteroides stercoris CC31F

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 PF13174: TPR_6" amino acids 174 to 198 (25 residues), 12.8 bits, see alignment (E = 7.9e-05) PF13432: TPR_16" amino acids 190 to 228 (39 residues), 18.7 bits, see alignment 1e-06 amino acids 207 to 261 (55 residues), 19.5 bits, see alignment 5.9e-07 PF13181: TPR_8" amino acids 235 to 264 (30 residues), 15.7 bits, see alignment (E = 6.8e-06)

Best Hits

KEGG orthology group: None (inferred from 64% identity to bhl:Bache_1904)

Predicted SEED Role

"TPR-domain containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>HMPREF1181_RS10835 tetratricopeptide repeat protein (Bacteroides stercoris CC31F)
MSKKNLLSGRDKELQELAEQYEAAKAENKPIYLDADDLADLADWYAMHRKNSQATEVVEY
GLSLHPGSTPLLVEQAYLFMDARERDKAKQVIEEITEDYSSEVKVLKANILLGEGKIDEA
EQLLDSIEDKEDLANIVDVSYMYIDMGYPDKAVPWLTRGLEKYAEEEEYLAVTADCFLAQ
GLKDKAEMFYNKLIDKNPYSAPYWFGLARCYFEQQLFDKAIEACDYAIVSDEEFADAYMM
KGHAFYQLGNEESALENYTLAEKYKAVSPNFLHMFIGFNEISKGHWEEGYRYLELVIHSK
DTDSTMLPSLYAHVAICLYNLGEKRQADLFFKKAHEIGPKDAEPYLIEGGMYMEKGDFDK
AVKKWALALECAPCADTWNEIGMSSMETGHIQYAQTAFEQVKKLEPDFENINEKLTALYL
LLDDMENFLKYNQLCAHPFQAKDLENMLDLLDCKNRDEMIKRVKEIFGGSGLF