Protein Info for HMPREF1181_RS10815 in Bacteroides stercoris CC31F

Annotation: riboflavin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00187: riboflavin synthase, alpha subunit
  • amino acids 1 to 198 (198 residues), 194.5 bits, E=6e-62
• PF00677: Lum_binding
  • amino acids 3 to 84 (82 residues), 70.5 bits, E=4.8e-24
  • amino acids 98 to 187 (90 residues), 80.8 bits, E=3e-27

Best Hits

KEGG orthology group: K00793, riboflavin synthase [EC: 2.5.1.9] (inferred from 92% identity to bhl:Bache_1923)

Predicted SEED Role

"Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9)" (EC 2.5.1.9)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.9

Protein Sequence (200 amino acids)

>HMPREF1181_RS10815 riboflavin synthase (Bacteroides stercoris CC31F)
MFSGIVEECATLVAMVRDQENVHFTFKCSFVNELKIDQSVSHNGVCLTVVSMTDDAYTVT
AMKETLDRSNLGLLKVGDEVNVERSMMMNGRLDGHIVQGHVDQTATCVDIKDAEGSYYFT
FRYAFDKEMAKRGYITVDKGSVTVNGVSLTVCNPTDDTFQVAIIPYTFEHTNFHAFKVGS
VVNLEFDIIGKYISRMIQYK