Protein Info for HMPREF1181_RS10585 in Bacteroides stercoris CC31F

Annotation: precorrin-4 C(11)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 PF11760: CbiG_N" amino acids 48 to 126 (79 residues), 117.6 bits, see alignment E=3.9e-38 PF11761: CbiG_mid" amino acids 131 to 243 (113 residues), 52 bits, see alignment E=1.4e-17 PF01890: CbiG_C" amino acids 246 to 361 (116 residues), 95.1 bits, see alignment E=8.3e-31 TIGR01465: precorrin-4 C11-methyltransferase" amino acids 373 to 617 (245 residues), 348.1 bits, see alignment E=1.2e-108 PF00590: TP_methylase" amino acids 375 to 578 (204 residues), 154.1 bits, see alignment E=1e-48

Best Hits

KEGG orthology group: None (inferred from 76% identity to bhl:Bache_2214)

Predicted SEED Role

"Cobalamin biosynthesis protein CbiG / Cobalt-precorrin-4 C11-methyltransferase (EC 2.1.1.133)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (618 amino acids)

>HMPREF1181_RS10585 precorrin-4 C(11)-methyltransferase (Bacteroides stercoris CC31F)
MKTAIMLVSETGMASARLLLKEFPEAEIFTPRYESGCTHIESTGSFTVKNFNRYDAFIFI
GALGICVRSIAPCVKDKYTDPAVICVDSIGKHAISVLSGHIGGANELTEAVAGALGAEPV
ITTQSDLTGLWALDKLPQRFGWSPTICVSPSTHLLAGLTQTPDDQMKACMNEAISLFVTG
QPTALLLEIRDKGTDWMEANLPPHVEVFYQMKDIKLSRFKLVLIVSPRIHYNIKDIPSIC
YVPRVVHVGIGLARQASPTRKVVKGIIEKLEEYNISPQSIITISTINVKRDEPVVKSLQK
EYEVFFYTAEELATMDVPHPSKTVMKHMGTPSVSEAAALLSSGNSQLIMPKRKGENYTVA
ATLDICAQRRGHIEIVGAGPGDPDLISVRGRAMLEKADLILYAGSLVPRELTLCAKPGAT
VRSSASMDLEEQFALMKEFYDQGKFIVRLHTGDPCIYGAIQEQMNYFDRYGMSYHITPGI
SSFQAAAAALKSQFTIPEKVQSIILTRGEGRTPMPEREKLHLMARSQSTMCIFLSASIAE
QVQAELLQEYPETTPVAVCYHLTWPDERIFRGELKDLARIVKENNLTLTTMIVVGEAIGN
RKGLSRLYAHEFKHLFRK