Protein Info for HMPREF1181_RS09690 in Bacteroides stercoris CC31F

Annotation: conjugative transposon protein TraK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details TIGR03781: Bacteroides conjugative transposon TraK protein" amino acids 6 to 207 (202 residues), 365.3 bits, see alignment E=3.9e-114

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2292)

Predicted SEED Role

"Conjugative transposon protein TraK" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>HMPREF1181_RS09690 conjugative transposon protein TraK (Bacteroides stercoris CC31F)
MEFKSLKNIETSFRQIRTMGIVFVSLCALVTGYALWSSYRFAERQREKIYVLDNGKSLIL
ALSQDLSQNRPVEAKEHIRRFHELFFTLSPDKAAIESNIRRALFLCDESAFRYYKDWEEK
GYYNRIISANINQSIRVDSVACDFNSYPYVVTTYARQSLVRSSNITERSLVTRCRLLNSV
RSDNNPHGFTMEQFNIVENRDLRTIER