Protein Info for HMPREF1181_RS09175 in Bacteroides stercoris CC31F

Annotation: 5'/3'-nucleotidase SurE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00087: 5'/3'-nucleotidase SurE
  • amino acids 8 to 242 (235 residues), 182.7 bits, E=4e-58
• PF01975: SurE
  • amino acids 8 to 191 (184 residues), 195.9 bits, E=2.9e-62

Best Hits

Swiss-Prot: 78% identical to SURE_BACFN: 5'-nucleotidase SurE (surE) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 90% identity to bhl:Bache_1253)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)

MetaCyc Pathways

• inosine 5'-phosphate degradation (3/4 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• guanosine nucleotides degradation II (2/4 steps found)
• guanosine nucleotides degradation III (2/4 steps found)
• purine nucleotides degradation II (aerobic) (7/11 steps found)
• superpathway of guanosine nucleotides degradation (plants) (3/6 steps found)
• adenosine nucleotides degradation II (2/5 steps found)
• purine nucleotides degradation I (plants) (7/12 steps found)
• ureide biosynthesis (3/7 steps found)
• NAD salvage (plants) (4/11 steps found)
• tunicamycin biosynthesis (2/9 steps found)
• superpathway of purines degradation in plants (7/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Protein Sequence (254 amino acids)

>HMPREF1181_RS09175 5'/3'-nucleotidase SurE (Bacteroides stercoris CC31F)
MENQRPLILISNDDGIIAKGISELIKFLRPLGEIVVMAPDAPRSGNACALTVTEPIHYQL
LRKDVGLTVYKCSGTPADCVKLAFHTVLDRKPDLVVGGINHGDNSSVNVHYSGTMGVVIE
GCLKGVPSIGFSLCNHMPDADFEPAGEYIREIARKVLEKGLPPLTCLNVNFPDTKELKGV
KICEQAKGQWTNEWENFAHRGDAHYYWLTGEFEESEKENEKSDHWALANGYVAVTPTTVD
VTAYGLMDELKTWF