Protein Info for HMPREF1181_RS09155 in Bacteroides stercoris CC31F

Annotation: ATP-dependent zinc metalloprotease FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 675 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details PF06480: FtsH_ext" amino acids 21 to 87 (67 residues), 45.4 bits, see alignment E=2.1e-15 TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 136 to 623 (488 residues), 699.7 bits, see alignment E=1.1e-214 PF00004: AAA" amino acids 228 to 360 (133 residues), 155.8 bits, see alignment E=2.1e-49 PF07728: AAA_5" amino acids 228 to 347 (120 residues), 22.3 bits, see alignment E=2.8e-08 PF17862: AAA_lid_3" amino acids 384 to 426 (43 residues), 57.2 bits, see alignment 2.3e-19 PF01434: Peptidase_M41" amino acids 442 to 622 (181 residues), 205.9 bits, see alignment E=1.4e-64

Best Hits

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 91% identity to bhl:Bache_1257)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (675 amino acids)

>HMPREF1181_RS09155 ATP-dependent zinc metalloprotease FtsH (Bacteroides stercoris CC31F)
MDNNTNKKPTKTNMPKFNLNWLYMIIAMMLLGLYLTNESGSASKNIPYDEFQEYVRNGYI
SKVTGYDDNSVEAYVKPQYVPNVFKADSSRVGKNPLITTEAPSRESLGDFLQKEKDETRF
DGSISYEKKHNYFGAILWQILPFAFLIGFWIFLSRRWSSGGGMGGGSGIFSVGKSKAQLF
EKNSPVKVTFKDVAGLAEAKQEVEEIVEFLKQPQKYTDLGGKIPKGALLVGPPGTGKTLL
AKAVAGEANVPFFSLAGSDFVEMFVGVGASRVRDLFRQAKEKAPCIVFIDEIDAVGRARG
KAAAMGGNDERENTLNQLLTEMDGFGSNSGVIILAATNRVDVLDKALLRAGRFDRQIHVD
LPDLNERKEVFGVHLRPIKIDNTVDVELLARQTPGFSGADIANVCNEAALIAARHGKKFV
EKQDFLDAVDRIVGGLEKKTKITTEEERRSIAIHEAGHASISWLLEYANPLIKVTIVPRG
RALGAAWYLPEERQITTKEQMLDEMCATLGGRAAEDLFIGRISTGAMNDLERVTKQAYGM
IAYLGMSDKLPNLCYYNNDEYSFNRPYSEKTAELIDEEVKRMVNEQYERAKKILSDNKEG
HNKLAQLLIDKEVIFAEDVEEIFGKRPWASRSEEIISASKTSRELKEAEEKEAAKAKEAE
KEVKEEESHNTGSNN