Protein Info for HMPREF1181_RS08960 in Bacteroides stercoris CC31F

Annotation: twin-arginine translocase subunit TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 181 to 207 (27 residues), see Phobius details amino acids 219 to 250 (32 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 9 to 250 (242 residues), 155 bits, see alignment E=1.3e-49 PF00902: TatC" amino acids 10 to 245 (236 residues), 211.6 bits, see alignment E=6e-67

Best Hits

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 91% identity to bhl:Bache_1324)

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>HMPREF1181_RS08960 twin-arginine translocase subunit TatC (Bacteroides stercoris CC31F)
MADKELTFWDHLDELRRVLFRILGVWFVLAVGYFIAMPYLFDNVVLAPCHNDFIFYDLLR
YIGEVFDLHDEFFTQEFQIKLININLAAPFFIHISTAFWMSVVTAAPYVFFEIWRFVSPA
LYPNERKGVRKALGLGTVMFFVGVLLGYFMVYPLTLRFLSTYQLSATIENQISLNSYIDN
FMMLVLCMGLAFELPLVTWLLSLLGLVHKTFLRKYRRHAVVIIVIVAAVITPTGDPFTLT
VVAVPLYLLYEMSILMIKDKKADETEEIIETGER