Protein Info for HMPREF1181_RS08925 in Bacteroides stercoris CC31F

Annotation: cupin domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07883: Cupin_2
  • amino acids 40 to 94 (55 residues), 51.2 bits, E=8.4e-18
• PF02311: AraC_binding
  • amino acids 49 to 93 (45 residues), 23.1 bits, E=5.4e-09

Best Hits

Swiss-Prot: 45% identical to KDGF_DICD3: Pectin degradation protein KdgF (kdgF) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 64% identity to bth:BT_3081)

MetaCyc: 40% identical to unsaturated pyranuronate lyase monomer (Halomonas sp. Victoria JH)
RXN-12877 [EC: 4.2.99.25]; 4.2.99.25 [EC: 4.2.99.25]

Predicted SEED Role

"Pectin degradation protein KdgF" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

MetaCyc Pathways

• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
• alginate degradation (2/7 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (15/31 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.25

Protein Sequence (115 amino acids)

>HMPREF1181_RS08925 cupin domain-containing protein (Bacteroides stercoris CC31F)
MKRTRSNAFILENEKAWEPAGEGVVRQILGYDGQVMLVKVKFEQGAVGTPHTHYHTQTTY
VASGKFEFTVNGEKQIVSAGDGVYIEPDAEHGCTCLEAGILIDCFSPMRADFLKP