Protein Info for HMPREF1181_RS08595 in Bacteroides stercoris CC31F

Annotation: aspartate--ammonia ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00669: aspartate--ammonia ligase
  • amino acids 22 to 337 (316 residues), 393.4 bits, E=4.6e-122
• PF03590: AsnA
  • amino acids 22 to 255 (234 residues), 348.6 bits, E=9.3e-109

Best Hits

Swiss-Prot: 89% identical to ASNA_BACTN: Aspartate--ammonia ligase (asnA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01914, aspartate--ammonia ligase [EC: 6.3.1.1] (inferred from 94% identity to bhl:Bache_3342)

MetaCyc: 51% identical to asparagine synthetase A (Escherichia coli K-12 substr. MG1655)
Aspartate--ammonia ligase. [EC: 6.3.1.1]

Predicted SEED Role

"Aspartate--ammonia ligase (EC 6.3.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 6.3.1.1)

MetaCyc Pathways

• superpathway of L-aspartate and L-asparagine biosynthesis (4/4 steps found)
• superpathway of L-asparagine biosynthesis (2/2 steps found)
• L-asparagine biosynthesis II (1/1 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Cyanoamino acid metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.1

Protein Sequence (345 amino acids)

>HMPREF1181_RS08595 aspartate--ammonia ligase (Bacteroides stercoris CC31F)
MSYLIKPEGYKPLLDLKQTELGIKQIKEFFQLNLSSELRLRRVTAPLFVLKGMGINDDLN
GVERAVSFPIKDLGDAQAEVVHSLAKWKRLTLAEYGIEPGYGIYTDMNAIRADEELGNLH
SLYVDQWDWERVITEQDRNIDFLKEIVTRIYAAMVRTEYMVYEMYPQIKPCLPQKLHFIH
AEELRQMYPNIEPKCREHAIAKKFGAVFIIGIGCKLSDGKKHDGRAPDYDDYTTPGLNGL
PGLNGDLLLWDDVLQRSVELSSMGIRVDKEALQRQLKQEGEEKRLELYFHKRLMGDALPL
SIGGGIGQSRLCMFYLRKAHIGEIQASIWPADMRSECKAHNIHLI