Protein Info for HMPREF1181_RS08315 in Bacteroides stercoris CC31F

Annotation: ketol-acid reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07991: IlvN
  • amino acids 28 to 192 (165 residues), 148.2 bits, E=2.6e-47
• TIGR00465: ketol-acid reductoisomerase
  • amino acids 28 to 346 (319 residues), 313.5 bits, E=6.6e-98
• PF03446: NAD_binding_2
  • amino acids 32 to 119 (88 residues), 31 bits, E=3.6e-11
• PF01450: IlvC
  • amino acids 200 to 344 (145 residues), 128.5 bits, E=3.8e-41

Best Hits

Swiss-Prot: 64% identical to ILVC_DESOH: Ketol-acid reductoisomerase (NAD(+)) (Dole_2039) from Desulfococcus oleovorans (strain DSM 6200 / Hxd3)

KEGG orthology group: K00053, ketol-acid reductoisomerase [EC: 1.1.1.86] (inferred from 95% identity to bhl:Bache_3319)

Predicted SEED Role

"Ketol-acid reductoisomerase (EC 1.1.1.86)" in subsystem Branched-Chain Amino Acid Biosynthesis or Coenzyme A Biosynthesis (EC 1.1.1.86)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (16/17 steps found)
• superpathway of coenzyme A biosynthesis I (bacteria) (9/9 steps found)
• superpathway of L-isoleucine biosynthesis I (11/13 steps found)
• L-valine biosynthesis (4/4 steps found)
• phosphopantothenate biosynthesis I (4/4 steps found)
• superpathway of L-threonine metabolism (14/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (6/7 steps found)
• pyruvate fermentation to isobutanol (engineered) (3/5 steps found)
• phosphopantothenate biosynthesis III (archaea) (2/4 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (4/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.86

Protein Sequence (347 amino acids)

>HMPREF1181_RS08315 ketol-acid reductoisomerase (Bacteroides stercoris CC31F)
MAQLNFGGVIENVMTREEFPLEKAREILKDETIAVIGYGVQGPGQACNLRDNGFNVIVGQ
RQGKTYEKAVADGWVPGETLFSIEDACQKGTIVMCLLSDAAVMSVWPTIKPFLTPGKALY
FSHGFAITWSDRTGVVPPTDIDVIMVAPKGSGTSLRTMFLEGRGLNSSYAIYQDATGKAL
DRTLALGIGIGSGYLFETTFIREATSDLTGERGSLMGAIQGLLLAQYEVLRENGHTPSEA
FNETVEELTQSLMPLFAKNGMDWMYANCSTTAQRGALDWMGPFHDAIKPVVQKLYQSVKS
GNEAQISIDSNSKPDYREKLNEELKALRESEMWQTAVTVRKLRPENN