Protein Info for HMPREF1181_RS08040 in Bacteroides stercoris CC31F

Annotation: inorganic phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 747 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 312 to 329 (18 residues), see Phobius details amino acids 401 to 421 (21 residues), see Phobius details amino acids 429 to 448 (20 residues), see Phobius details amino acids 458 to 506 (49 residues), see Phobius details PF01384: PHO4" amino acids 26 to 325 (300 residues), 66.9 bits, see alignment E=8.8e-23

Best Hits

KEGG orthology group: None (inferred from 89% identity to bhl:Bache_3273)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (747 amino acids)

>HMPREF1181_RS08040 inorganic phosphate transporter (Bacteroides stercoris CC31F)
METIYLCIVIFLFVLAVFDLVVGVSNDAVNFLQSAVGAKAASFKTILFIAGIGVFIGAAL
SNGMMDIARHGIYQPEHFYFAEIMCILLAVMLTDVVLLDVFNTMGMPTSTTVSMVFELLG
GTFALALIKVYGSDTLGLGDLINTDKALSVIMAIFVSVAIAFFFGMLVQWLARIVFTFNY
TKKMKYSIGIFGGIAATSIIYFMLIKGLKDSSFMTPENKHWIQENTAMLIGCFFVFFTIL
MQVLHWCKVNVFKIVVLLGTFALALAFAGNDLVNFIGVPLAGYSSFIDYTTNGTAAGPDG
FLMTSLLGPAKTPWYFLIGAGAIMVYALCTSKKAHNVIKTSVDLSRQDEGEESFGSTPIA
RTLVRFSMTIANGLSKVMPESGKRWIETRFQKDEAIIADGAAFDLVRASINLVLAGLLIA
LGTSLKLPLSTTYVTFMVAMGTSLADRAWGRDSAVFRITGVLSVIGGWFITAGAAFTICF
FVTFVIHFGGTIAIIALIGLAVFMLIRSQVMYKKRKEKEKGNATIKQLMQSTDNMEILEL
LRKHTREELGKILEFTEDNFERTVTAFLHENLRGLRRAMGSVKFEKQLIKQMKRTGTLAM
CRLDNNTVLEKGLYYYQGNDFASELVYSVGRLCEPCLEHIDNNFKPLDTIQKGEFADVTE
DIVYLLQVCRHKLENNNYNNFEEDIHKANDLNGQLAHLKREELQRIQSQSGSIKVSMVYL
TMIQEAQNIVTYSINLMKVSRKFQAEE