Protein Info for HMPREF1181_RS07900 in Bacteroides stercoris CC31F

Annotation: 1-deoxy-D-xylulose-5-phosphate reductoisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00243: 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  • amino acids 3 to 380 (378 residues), 488.9 bits, E=5.3e-151
• PF02670: DXP_reductoisom
  • amino acids 5 to 131 (127 residues), 164.1 bits, E=4.1e-52
• PF08436: DXP_redisom_C
  • amino acids 145 to 228 (84 residues), 138.3 bits, E=1.2e-44
• PF13288: DXPR_C
  • amino acids 260 to 376 (117 residues), 140.1 bits, E=5.9e-45

Best Hits

Swiss-Prot: 86% identical to DXR_BACFN: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (dxr) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K00099, 1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC: 1.1.1.267] (inferred from 92% identity to bhl:Bache_3220)

MetaCyc: 46% identical to 1-deoxy-D-xylulose 5-phosphate reductoisomerase (Croton stellatopilosus)
1-deoxy-D-xylulose-5-phosphate reductoisomerase. [EC: 1.1.1.267]

Predicted SEED Role

"1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC 1.1.1.267)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 1.1.1.267)

MetaCyc Pathways

• methylerythritol phosphate pathway II (9/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (9/12 steps found)
• taxadiene biosynthesis (engineered) (9/13 steps found)
• methylerythritol phosphate pathway I (6/9 steps found)
• isoprene biosynthesis I (6/10 steps found)
• superpathway of ergosterol biosynthesis II (8/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.267

Protein Sequence (385 amino acids)

>HMPREF1181_RS07900 1-deoxy-D-xylulose-5-phosphate reductoisomerase (Bacteroides stercoris CC31F)
MKKQIAILGSTGSIGTQALQVIEEHPDRYEAYVLTANNRVEDLIAQARKFKPEAVVIANE
TKYQQLKDALADLPIKVYAGEEALCQIVAEKPIDMVLTAMVGYAGLKPTMNAIRARKTIA
LANKETLVVAGELINDLARFSGTPILPVDSEHSAVFQCLAGEMGNPVEKVILTASGGPFR
TCTMEQLATVTKAQALKHPNWDMGAKITIDSASMMNKGFEVIEAKWLFGVRPDQIEVVVH
PQSVIHSMVQFEDGAVKAQLGMPDMRLPIQYAFSYPERLKASFPRLDFKLCTDLTFEQPD
TKRFRNLALAYEALHRAGNMPCIVNAANEVVVAAFLRDEISFLGMSDVIEKTMARVSFIQ
KPAYEDYVATDAEARRIAKELIVKN