Protein Info for HMPREF1181_RS07645 in Bacteroides stercoris CC31F

Annotation: thiamine-phosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 9 to 339 (331 residues), 326.5 bits, E=7.6e-102
• PF00586: AIRS
  • amino acids 33 to 145 (113 residues), 105.4 bits, E=2.3e-34

Best Hits

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 91% identity to bhl:Bache_3177)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage II (4/5 steps found)
• thiamine diphosphate salvage V (2/3 steps found)
• thiamine diphosphate salvage I (1/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Protein Sequence (353 amino acids)

>HMPREF1181_RS07645 thiamine-phosphate kinase (Bacteroides stercoris CC31F)
MRTEIATLGEFGLIRHLTESIELKNESSRYGIGDDAAVLSYPANKEVLVTTDLLLEGVHF
DLTYVPLKHLGYKSAVVNFSDIYAMNGTPRQITVSLGLSKRFSVEDMEELYAGIRLACEE
YGVDIVGGDTSSSYTGLTISITCIGEGEKGKVVYRNGAKETDLICVSGDLGAAYMGLQLL
EREKSVLKGGDKDLQPDFAGKEYLLERQLKPEARRDIIQKLAKEGIQPTSMMDVSDGLSS
ELLHICTQSKVGCRIYEEHIPIDYQTAVMAEEFNMNLTTCALNGGEDYELLFTVPIADHE
KVSEMEGIKLIGHITKPELGCALISRDGQEFELKAQGWNPLKEESAAQQEEVE