Protein Info for HMPREF1181_RS07430 in Bacteroides stercoris CC31F

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13145: Rotamase_2" amino acids 109 to 235 (127 residues), 28.3 bits, see alignment E=4.1e-10 PF13616: Rotamase_3" amino acids 114 to 224 (111 residues), 35.4 bits, see alignment E=2.1e-12 PF00639: Rotamase" amino acids 132 to 222 (91 residues), 39.6 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: None (inferred from 59% identity to bhl:Bache_0192)

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>HMPREF1181_RS07430 peptidylprolyl isomerase (Bacteroides stercoris CC31F)
MVMIRTCLVMIFSGVSWFAFSQQDPVLMRVNGKDVLRSEFEYYYNKDAASFASGYVAPEK
YAEKFVDFKLKVSAAETAGLDTALSFREKVENYRNRLIKSYLTDTAVIENEARRLYDKMK
ASHHAGRVRVSHIFKYLPQNVSGHALRKAIAGMDSIYEYLRRNQTPEAFDACVKRFSDEK
QPFWVSWLQMPVEFENVAFELSAGEVSQPFFTPQGIHIVKVIERMEMPSFDDVKNGMAVC
RAHRHGTDWGVEAQVEKLKKEYGYAPDKTGMDELIRIGQTKRTLFTLAGKSYTGNDFVRF
AAAYPAGVRRQLDAFVMKTVLDYENVCLERKYPKLRYQVEEYRNRLLLDKITGQEIQKRI
GSDEVGLQTYFEKHRSDYQWREQRYKGIVLHGVSKRIVKQARKFLKSLPEEEWKDAIRLT
FNAGAQPQIQAEQGTFASGDNVYVDDLVFKGKDAAPMVSFPFTAVLGKKVKAPDDYREVK
DRVVTDYRNCLEKQWITRLRTSAKVEINQEVLKTVNNH