Protein Info for HMPREF1181_RS06930 in Bacteroides stercoris CC31F

Annotation: tRNA 2-thiouridine(34) synthase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 PF03054: tRNA_Me_trans" amino acids 6 to 191 (186 residues), 184.4 bits, see alignment E=4.3e-58 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 6 to 345 (340 residues), 294.6 bits, see alignment E=4.5e-92 PF20259: tRNA_Me_trans_M" amino acids 196 to 262 (67 residues), 60.8 bits, see alignment E=1.5e-20 PF20258: tRNA_Me_trans_C" amino acids 278 to 345 (68 residues), 62.4 bits, see alignment E=8.1e-21

Best Hits

Swiss-Prot: 81% identical to MNMA3_BACFN: tRNA-specific 2-thiouridylase MnmA 3 (mnmA3) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 86% identity to bhl:Bache_0137)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>HMPREF1181_RS06930 tRNA 2-thiouridine(34) synthase MnmA (Bacteroides stercoris CC31F)
MNKAEKRVLVGMSGGIDSTATCLMLQEQGYEVIGLTMWVWGEEPLEARQLAQNMGIEHYV
ADEREAFREVIVRNFIDEYRQGRTPNPCVMCNPLFKFRILTEWADKLNCRYIATGHYTRL
EEQNRKIYIVAGDDDKKDQSYFLWRLGQDVLRRCLFPLGTYTKMQVRDYLRDKGYAPKAE
EGESMEVCFIKGDYRDFLREHSPEIDNEVGPGWFVNSEGVKLGEHKGFPYYTIGQRKGLE
IALGKPAYVLKINPQKNTVMLGDAEQLKAEYMLAEQDNLIDEGEVFGSGELTVRIRYRSK
PIPCSVKRLEDGRLLVHFETEASAIAPGQSAVFYIGKRVVGGSFIASQRGIGMYI