Protein Info for HMPREF1181_RS06620 in Bacteroides stercoris CC31F

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF12804: NTP_transf_3" amino acids 4 to 133 (130 residues), 43.5 bits, see alignment E=4.1e-15 PF01128: IspD" amino acids 4 to 219 (216 residues), 162.3 bits, see alignment E=1.6e-51 TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase" amino acids 4 to 218 (215 residues), 194.1 bits, see alignment E=1.1e-61

Best Hits

Swiss-Prot: 76% identical to ISPD_BACFR: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 77% identity to bhl:Bache_0085)

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>HMPREF1181_RS06620 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Bacteroides stercoris CC31F)
MKYVLIVAGGKGLRMGCELPKQFLPIGGKPVLMRTIEAFYAYSPEIRIILVLPCNQQAYW
NELCRKHGFSIPHQIADGGETRFHSVKNGLAFVTTPGLVGVHDGIRPFVAQEVIARCYSL
AAGKQAVIPVTDVVETVRHLVGEGSETVSRDAYKLVQTPQVFDADLLKQAYEQPYTSHFT
DDASVVEALGKPVYLTEGNRENIKITTPFDLKIAAALLDSCSI