Protein Info for HMPREF1181_RS06415 in Bacteroides stercoris CC31F

Annotation: Cof-type HAD-IIB family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 TIGR01484: HAD hydrolase, family IIB" amino acids 4 to 229 (226 residues), 70.8 bits, see alignment E=1.7e-23 TIGR00099: Cof-like hydrolase" amino acids 5 to 256 (252 residues), 204.5 bits, see alignment E=2.1e-64 PF08282: Hydrolase_3" amino acids 5 to 256 (252 residues), 195 bits, see alignment E=4.9e-61 PF05116: S6PP" amino acids 178 to 237 (60 residues), 30 bits, see alignment E=9.8e-11 PF00702: Hydrolase" amino acids 180 to 224 (45 residues), 28.9 bits, see alignment 3.8e-10

Best Hits

KEGG orthology group: K07024, (no description) (inferred from 69% identity to bhl:Bache_1360)

Predicted SEED Role

"Hydrolase (HAD superfamily) in cluster with DUF1447" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>HMPREF1181_RS06415 Cof-type HAD-IIB family hydrolase (Bacteroides stercoris CC31F)
MIKALFFDIDGTLVSFKTHQIPVSTIEALEAAKAKGIQIFISTGRPRVIINNLAALQERK
LIDGYITMNGAYCFVDDTVIYKSPIPAAEVDALTGFCHERNLPCILVGEHDICVNQPGEL
VTEIFNRQLKTDPIPPKPYTDNHSDKEYYQLTPFIDIEEEQLLLPSIPNCEMGRWHPAFV
DVTAKGNTKQRGIDEIIRHFGIRLEETMAFGDGGNDISMLRHAGIGVAMGNAKDDVKAAA
GYVTTSVDDNGIANALKQYGIIES