Protein Info for HMPREF1181_RS06270 in Bacteroides stercoris CC31F

Annotation: hypoxanthine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01203: hypoxanthine phosphoribosyltransferase
  • amino acids 13 to 176 (164 residues), 170.8 bits, E=1.1e-54
• PF00156: Pribosyltran
  • amino acids 18 to 163 (146 residues), 102.1 bits, E=1e-33

Best Hits

Swiss-Prot: 38% identical to HPRT_MYCLE: Hypoxanthine-guanine phosphoribosyltransferase (hpt) from Mycobacterium leprae (strain TN)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 94% identity to bfr:BF1119)

MetaCyc: 35% identical to hypoxanthine phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Hypoxanthine phosphoribosyltransferase. [EC: 2.4.2.8]; 2.4.2.8 [EC: 2.4.2.8]

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (11/14 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• xanthine and xanthosine salvage (2/2 steps found)
• adenine and adenosine salvage III (3/4 steps found)
• adenine salvage (2/3 steps found)
• superpathway of guanine and guanosine salvage (2/3 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Protein Sequence (178 amino acids)

>HMPREF1181_RS06270 hypoxanthine phosphoribosyltransferase (Bacteroides stercoris CC31F)
MDTIQIKDKMFTVSIKEQDILKEVTRVANEINRDLAGKNPLFLSVLNGSFMFTSDLMKRI
TIPCEISFVKLASYQGVSSTGVIKEVIGINEDISGRTIVIVEDIVDTGLTMQRLLETLGT
RGPKEIHIASLLVKPDKLKVDLNIEYVAMNIPNDFIVGYGLDYDGFGRNYPDIYTVVD