Protein Info for HMPREF1181_RS06130 in Bacteroides stercoris CC31F

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 5 to 190 (186 residues), 209.4 bits, E=3.1e-66
• PF00117: GATase
  • amino acids 7 to 186 (180 residues), 134.4 bits, E=1e-42
• PF07722: Peptidase_C26
  • amino acids 59 to 169 (111 residues), 40.5 bits, E=6.8e-14
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 199 to 517 (319 residues), 456.1 bits, E=6.1e-141
• PF02540: NAD_synthase
  • amino acids 205 to 274 (70 residues), 31.5 bits, E=2.5e-11
• PF03054: tRNA_Me_trans
  • amino acids 215 to 247 (33 residues), 22.3 bits, see alignment (E = 2.4e-08)
• PF00958: GMP_synt_C
  • amino acids 429 to 516 (88 residues), 138.7 bits, E=1.3e-44

Best Hits

Swiss-Prot: 91% identical to GUAA_BACFN: GMP synthase [glutamine-hydrolyzing] (guaA) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 91% identity to bfs:BF0887)

MetaCyc: 52% identical to GMP synthase monomer (Saccharomyces cerevisiae)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (18/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (20/26 steps found)
• superpathway of purine nucleotide salvage (11/14 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• guanosine ribonucleotides de novo biosynthesis (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (4/6 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (517 amino acids)

>HMPREF1181_RS06130 glutamine-hydrolyzing GMP synthase (Bacteroides stercoris CC31F)
MQEKIIILDFGSQTTQLIGRRVRELNVYCEIVPYNKFPQGDASVKGVILSGSPFSVYDES
AFKIDLNEIRGKYPILGICYGAQFIAYTNGGKVEPAGSREYGRAHLASFDKNNVLFKGVK
ENTQVWMSHGDTITAIPESFKTIASTDKVKIAAYQVEGEKMWGVQFHPEVFHSEDGTQML
KNFVVEVCGCRQDWSAASFIETTVAQLKEQLGDDKVVLGLSGGVDSSVAAVLLNRAIGKN
LTCIFVDHGMLRKDEFKNVLHDYECLGLNVIGVDASAKFFAELAGVTEPEKKRKIIGKGF
IDVFDEEAHKIKDVKWLAQGTIYPDCIESLSITGTVIKSHHNVGGLPEKMNLKLCEPLRL
LFKDEVRRVGRELGMPEHLITRHPFPGPGLAVRILGDITPEKVSILQDADDIFIQGLRNW
KVKDAGGNETTLYHQVWQAGVILLPVQSVGVMGDERTYERAVALRAVTSTDAMTADWAHL
PYEFLGKVSNDIINKVKGVNRVTYDISSKPPSTIEWE