Protein Info for HMPREF1181_RS05975 in Bacteroides stercoris CC31F

Annotation: 3-deoxy-8-phosphooctulonate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR01362: 3-deoxy-8-phosphooctulonate synthase" amino acids 11 to 266 (256 residues), 388.2 bits, see alignment E=7.3e-121 PF00793: DAHP_synth_1" amino acids 12 to 261 (250 residues), 219.3 bits, see alignment E=2.4e-69

Best Hits

Swiss-Prot: 56% identical to KDSA_KORVE: 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA) from Koribacter versatilis (strain Ellin345)

KEGG orthology group: K01627, 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC: 2.5.1.55] (inferred from 94% identity to bth:BT_4321)

MetaCyc: 50% identical to 3-deoxy-8-phosphooctulonate synthase subunit (Arabidopsis thaliana col)
3-deoxy-8-phosphooctulonate synthase. [EC: 2.5.1.55]

Predicted SEED Role

"2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase (EC 2.5.1.55)" in subsystem KDO2-Lipid A biosynthesis (EC 2.5.1.55)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>HMPREF1181_RS05975 3-deoxy-8-phosphooctulonate synthase (Bacteroides stercoris CC31F)
MIELKNNPAGNFFLLAGPCVIEGEDMAMRIAERVVAITDKLQIPYVFKGSYRKANRSRLD
SFMGIGDEKALKILKKVHDTFGVPTVTDIHAAEEAAMAAEYVDILQIPAFLCRQTDLLVA
AAKTGKTVNIKKGQFLSPLAMQFAADKVVEAGNKNVMITERGTTFGYQDLVVDYRGIPEM
QTFGFPVILDVTHSLQQPNQTSGVTGGMPQLIETIAKAGIAVGADGLFIETHENPAVAKS
DGANMLKLDLLEGLLTRLVRIREAIK