Protein Info for HMPREF1181_RS05615 in Bacteroides stercoris CC31F

Annotation: chromate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 142 to 173 (32 residues), see Phobius details PF02417: Chromate_transp" amino acids 7 to 170 (164 residues), 184.7 bits, see alignment E=7.1e-59

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 88% identity to bfs:BF3156)

Predicted SEED Role

"Chromate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>HMPREF1181_RS05615 chromate transporter (Bacteroides stercoris CC31F)
MTNIYTEAFSIFFKIGAFTIGGGYAMVPLIEDEIVTKRRWIAKEDFIDLLAIAQSAPGIL
AVNISIFIGYRLRGIRGSIVTALGTILPSFLIILAIALFFHNFKDNVYVERIFKGIRPAV
VALIAAPTFSMAKSAKINRYTIWIPVVSALLIWLLGFSPIWIIIAAGIGGYLFGRLRFPK
TNS